Lineage for d4ew3a1 (4ew3 A:1-203)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892510Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2892511Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2892512Family c.65.1.1: Formyltransferase [53329] (5 proteins)
  6. 2892519Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)
  7. 2892541Species Human (Homo sapiens) [TaxId:9606] [82468] (30 PDB entries)
  8. 2892545Domain d4ew3a1: 4ew3 A:1-203 [220888]
    Other proteins in same PDB: d4ew3a2
    automated match to d1meoa_
    complexed with dxz, po4, so4

Details for d4ew3a1

PDB Entry: 4ew3 (more details), 1.7 Å

PDB Description: The structure of human glycinamide ribonucleotide transformylase in complex with 10R-methylthio-DDATHF.
PDB Compounds: (A:) Trifunctional purine biosynthetic protein adenosine-3

SCOPe Domain Sequences for d4ew3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ew3a1 c.65.1.1 (A:1-203) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]}
arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
lqlvasgtvqlgengkicwvkee

SCOPe Domain Coordinates for d4ew3a1:

Click to download the PDB-style file with coordinates for d4ew3a1.
(The format of our PDB-style files is described here.)

Timeline for d4ew3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ew3a2