SCOPe 2.06: Domain d4ew2a1: 4ew2 A:1-203

Lineage for d4ew2a1 (4ew2 A:1-203)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.65: Formyltransferase [53327] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest

4. Superfamily c.65.1: Formyltransferase [53328] (2 families)

5. Family c.65.1.1: Formyltransferase [53329] (5 proteins)

6. Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82468] (27 PDB entries)

8. Domain d4ew2a1: 4ew2 A:1-203 [220887]
   Other proteins in same PDB: d4ew2a2
   automated match to d1meoa_
   complexed with dxy, po4, so4

Details for d4ew2a1

PDB Entry: 4ew2, 1.6 Å

PDB Description: The structure of human glycinamide ribonucleotide transformylase in complex with 10S-methylthio-DDATHF.

PDB Compounds: (A:) Trifunctional purine biosynthetic protein adenosine-3

SCOPe Domain Sequences for d4ew2a1:

Sequence; same for both SEQRES and ATOM records:

>d4ew2a1 c.65.1.1 (A:1-203) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]}
arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
lqlvasgtvqlgengkicwvkee

Timeline for d4ew2a1:

• d4ew2a1 first appeared in SCOPe 2.03, called d4ew2a_
  
• d4ew2a1 was called d4ew2a_ in SCOPe 2.05
  
• d4ew2a1 appears in SCOPe 2.07
  
• d4ew2a1 appears in the current release, SCOPe 2.08