Lineage for d4evyb_ (4evy B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2968982Species Acinetobacter haemolyticus [TaxId:29430] [226372] (2 PDB entries)
  8. 2968984Domain d4evyb_: 4evy B: [220885]
    Other proteins in same PDB: d4evya2
    automated match to d1s5ka_
    complexed with cl, k, toy

Details for d4evyb_

PDB Entry: 4evy (more details), 1.77 Å

PDB Description: crystal structure of aminoglycoside antibiotic 6'-n-acetyltransferase aac(6')-ig from acinetobacter haemolyticus in complex with tobramycin
PDB Compounds: (B:) Aminoglycoside N(6')-acetyltransferase type 1

SCOPe Domain Sequences for d4evyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4evyb_ d.108.1.0 (B:) automated matches {Acinetobacter haemolyticus [TaxId: 29430]}
mnikpaseaslkdwlelrnklwsdseashlqemhqllaekyalqllaysdhqaiamleas
irfeyvngtetspvgflegiyvlpahrrsgvatmlirqaevwakqfsctefasdaaldnv
ishamhrslgfqetekvvyfskkid

SCOPe Domain Coordinates for d4evyb_:

Click to download the PDB-style file with coordinates for d4evyb_.
(The format of our PDB-style files is described here.)

Timeline for d4evyb_: