| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
| Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
| Protein automated matches [190038] (49 species) not a true protein |
| Species Acinetobacter haemolyticus [TaxId:29430] [226372] (2 PDB entries) |
| Domain d4evyb_: 4evy B: [220885] Other proteins in same PDB: d4evya2 automated match to d1s5ka_ complexed with cl, k, toy |
PDB Entry: 4evy (more details), 1.77 Å
SCOPe Domain Sequences for d4evyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4evyb_ d.108.1.0 (B:) automated matches {Acinetobacter haemolyticus [TaxId: 29430]}
mnikpaseaslkdwlelrnklwsdseashlqemhqllaekyalqllaysdhqaiamleas
irfeyvngtetspvgflegiyvlpahrrsgvatmlirqaevwakqfsctefasdaaldnv
ishamhrslgfqetekvvyfskkid
Timeline for d4evyb_: