![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d4evnp2: 4evn P:113-215 [220881] Other proteins in same PDB: d4evnb1, d4evnd1, d4evnf1, d4evnh1, d4evnj1, d4evnl1, d4evnn1, d4evnp1 automated match to d2fb4l2 |
PDB Entry: 4evn (more details), 2.85 Å
SCOPe Domain Sequences for d4evnp2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4evnp2 b.1.1.2 (P:113-215) automated matches {Human (Homo sapiens) [TaxId: 9606]} qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvapte
Timeline for d4evnp2: