Lineage for d1bgml2 (1bgm L:626-730)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 161124Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 161125Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 161126Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 161127Species Escherichia coli [TaxId:562] [49306] (23 PDB entries)
  8. 161247Domain d1bgml2: 1bgm L:626-730 [22088]
    Other proteins in same PDB: d1bgmi3, d1bgmi4, d1bgmi5, d1bgmj3, d1bgmj4, d1bgmj5, d1bgmk3, d1bgmk4, d1bgmk5, d1bgml3, d1bgml4, d1bgml5, d1bgmm3, d1bgmm4, d1bgmm5, d1bgmn3, d1bgmn4, d1bgmn5, d1bgmo3, d1bgmo4, d1bgmo5, d1bgmp3, d1bgmp4, d1bgmp5

Details for d1bgml2

PDB Entry: 1bgm (more details), 2.5 Å

PDB Description: beta-galactosidase (chains i-p)

SCOP Domain Sequences for d1bgml2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgml2 b.1.4.1 (L:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOP Domain Coordinates for d1bgml2:

Click to download the PDB-style file with coordinates for d1bgml2.
(The format of our PDB-style files is described here.)

Timeline for d1bgml2: