Lineage for d4evnj2 (4evn J:113-215)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2752120Domain d4evnj2: 4evn J:113-215 [220875]
    Other proteins in same PDB: d4evnb1, d4evnd1, d4evnf1, d4evnh1, d4evnj1, d4evnl1, d4evnn1, d4evnp1
    automated match to d2fb4l2

Details for d4evnj2

PDB Entry: 4evn (more details), 2.85 Å

PDB Description: crystal structure of fab cr6261 (somatic heavy chain with germline- reverted light chain)
PDB Compounds: (J:) Fab Lambda Light Chain

SCOPe Domain Sequences for d4evnj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4evnj2 b.1.1.2 (J:113-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

SCOPe Domain Coordinates for d4evnj2:

Click to download the PDB-style file with coordinates for d4evnj2.
(The format of our PDB-style files is described here.)

Timeline for d4evnj2: