Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries) |
Domain d4evnb1: 4evn B:3-112 [220866] Other proteins in same PDB: d4evnb2, d4evnd2, d4evnf2, d4evnh2, d4evnj2, d4evnl2, d4evnn2, d4evnp2 automated match to d2mcg11 |
PDB Entry: 4evn (more details), 2.85 Å
SCOPe Domain Sequences for d4evnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4evnb1 b.1.1.0 (B:3-112) automated matches {Human (Homo sapiens) [TaxId: 9606]} vltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgipdr fsgsksgtsatlgitglqtgdeadyycgtwdsslsayvvfgggtkltvlg
Timeline for d4evnb1: