Lineage for d4evea_ (4eve A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2314869Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2315050Species Helicobacter pylori, Nap [TaxId:210] [81743] (7 PDB entries)
  8. 2315051Domain d4evea_: 4eve A: [220864]
    automated match to d2cf7a_
    complexed with so4

Details for d4evea_

PDB Entry: 4eve (more details), 2.1 Å

PDB Description: Crystal Structure HP-NAP from strain YS29 in apo form
PDB Compounds: (A:) Neutrophil-activating protein

SCOPe Domain Sequences for d4evea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4evea_ a.25.1.1 (A:) Dodecameric ferritin homolog {Helicobacter pylori, Nap [TaxId: 210]}
mktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyeefadmfddlaerivq
lghhplvtlseaikltrvkeetktsfhskdifkeiledykhlekefkelsntaekegdkv
tvtyaddqlaklqksiwmlqahla

SCOPe Domain Coordinates for d4evea_:

Click to download the PDB-style file with coordinates for d4evea_.
(The format of our PDB-style files is described here.)

Timeline for d4evea_: