Lineage for d4evca_ (4evc A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1264123Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1264537Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 1264678Species Helicobacter pylori, Nap [TaxId:210] [81743] (7 PDB entries)
  8. 1264682Domain d4evca_: 4evc A: [220862]
    automated match to d2cf7a_
    complexed with cd

Details for d4evca_

PDB Entry: 4evc (more details), 2.4 Å

PDB Description: Crystal Structure HP-NAP from strain YS39 cadmium loaded (Cocrystallization 50mM)
PDB Compounds: (A:) Neutrophil-activating protein

SCOPe Domain Sequences for d4evca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4evca_ a.25.1.1 (A:) Dodecameric ferritin homolog {Helicobacter pylori, Nap [TaxId: 210]}
ktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyegfadmfddlaeriaql
ghhplvtlsealkltrvkeetktsfhskdifkeiledykhlekefkelsntaekegdkvt
vtyaddqlaklqksiwmlqahla

SCOPe Domain Coordinates for d4evca_:

Click to download the PDB-style file with coordinates for d4evca_.
(The format of our PDB-style files is described here.)

Timeline for d4evca_: