SCOPe 2.08: Domain d4evba_: 4evb A:

Lineage for d4evba_ (4evb A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Dodecameric ferritin homolog [47250] (16 species)

7. Species Helicobacter pylori, Nap [TaxId:210] [81743] (7 PDB entries)

8. Domain d4evba_: 4evb A: [220861]
   automated match to d2cf7a_
   complexed with edo, so4, zn

Details for d4evba_

PDB Entry: 4evb, 2.5 Å

PDB Description: Crystal Structure HP-NAP from strain YS39 zinc soaked (20mM)

PDB Compounds: (A:) Neutrophil-activating protein

SCOPe Domain Sequences for d4evba_:

Sequence; same for both SEQRES and ATOM records:

>d4evba_ a.25.1.1 (A:) Dodecameric ferritin homolog {Helicobacter pylori, Nap [TaxId: 210]}
ktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyegfadmfddlaeriaql
ghhplvtlsealkltrvkeetktsfhskdifkeiledykhlekefkelsntaekegdkvt
vtyaddqlaklqksiwmlqahla

Timeline for d4evba_:

• d4evba_ first appeared in SCOPe 2.03
  
• d4evba_ appears in SCOPe 2.07