| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein Dodecameric ferritin homolog [47250] (16 species) |
| Species Helicobacter pylori, Nap [TaxId:210] [81743] (7 PDB entries) |
| Domain d4evba_: 4evb A: [220861] automated match to d2cf7a_ complexed with edo, so4, zn |
PDB Entry: 4evb (more details), 2.5 Å
SCOPe Domain Sequences for d4evba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4evba_ a.25.1.1 (A:) Dodecameric ferritin homolog {Helicobacter pylori, Nap [TaxId: 210]}
ktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyegfadmfddlaeriaql
ghhplvtlsealkltrvkeetktsfhskdifkeiledykhlekefkelsntaekegdkvt
vtyaddqlaklqksiwmlqahla
Timeline for d4evba_: