Lineage for d4evaa_ (4eva A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006339Protein beta-Catenin [48373] (2 species)
  7. 2006354Species Mouse (Mus musculus) [TaxId:10090] [48374] (13 PDB entries)
  8. 2006356Domain d4evaa_: 4eva A: [220859]
    automated match to d1m1ea_
    complexed with ure

Details for d4evaa_

PDB Entry: 4eva (more details), 2 Å

PDB Description: Crystal Structure of Mouse Catenin beta-59 in 5.6M urea
PDB Compounds: (A:) Catenin beta-1

SCOPe Domain Sequences for d4evaa_:

Sequence, based on SEQRES records: (download)

>d4evaa_ a.118.1.1 (A:) beta-Catenin {Mouse (Mus musculus) [TaxId: 10090]}
lndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntndvetarctagtlh
nlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqegakmavrlaggl
qkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvnimrtytyekllwt
tsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnlsdaatkqegme
gllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvrtvlragdred
itepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplikatvglirnlal
cpanhaplreqgaiprlvqllvrahqdtqrrtsmggtqqqfvegvrmeeivegctgalhi
lardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieaegatap
ltellhsrnegvatyaaavlfrm

Sequence, based on observed residues (ATOM records): (download)

>d4evaa_ a.118.1.1 (A:) beta-Catenin {Mouse (Mus musculus) [TaxId: 10090]}
lndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntndvetarctagtlh
nlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqegakmavrlaggl
qkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvnimrtytyekllwt
tsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnlsdaatkqegme
gllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvrtvlragdred
itepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplikatvglirnlal
cpanhaplreqgaiprlvqllvrahqdtqregvrmeeivegctgalhilardvhnrivir
glntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieaegatapltellhsrnegv
atyaaavlfrm

SCOPe Domain Coordinates for d4evaa_:

Click to download the PDB-style file with coordinates for d4evaa_.
(The format of our PDB-style files is described here.)

Timeline for d4evaa_: