Lineage for d4ev8a_ (4ev8 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1500528Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1500529Family a.118.1.1: Armadillo repeat [48372] (7 proteins)
  6. 1500530Protein beta-Catenin [48373] (2 species)
  7. 1500545Species Mouse (Mus musculus) [TaxId:10090] [48374] (13 PDB entries)
  8. 1500546Domain d4ev8a_: 4ev8 A: [220858]
    automated match to d1m1ea_
    complexed with ure

Details for d4ev8a_

PDB Entry: 4ev8 (more details), 1.9 Å

PDB Description: Crystal structure of mouse catenin beta-59 in 2.4M urea.
PDB Compounds: (A:) Catenin beta-1

SCOPe Domain Sequences for d4ev8a_:

Sequence, based on SEQRES records: (download)

>d4ev8a_ a.118.1.1 (A:) beta-Catenin {Mouse (Mus musculus) [TaxId: 10090]}
llndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntndvetarctagtl
hnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqegakmavrlagg
lqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvnimrtytyekllw
ttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnlsdaatkqegm
egllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvrtvlragdre
ditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplikatvglirnla
lcpanhaplreqgaiprlvqllvrahqdtqrrtsmggtqqqfvegvrmeeivegctgalh
ilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieaegata
pltellhsrnegvatyaaavlfrm

Sequence, based on observed residues (ATOM records): (download)

>d4ev8a_ a.118.1.1 (A:) beta-Catenin {Mouse (Mus musculus) [TaxId: 10090]}
llndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntndvetarctagtl
hnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqegakmavrlagg
lqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvnimrtytyekllw
ttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnlsdaatkqegm
egllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvrtvlragdre
ditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplikatvglirnla
lcpanhaplreqgaiprlvqllvrahqdtqregvrmeeivegctgalhilardvhnrivi
rglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieaegatapltellhsrneg
vatyaaavlfrm

SCOPe Domain Coordinates for d4ev8a_:

Click to download the PDB-style file with coordinates for d4ev8a_.
(The format of our PDB-style files is described here.)

Timeline for d4ev8a_: