SCOPe 2.06: Domain d4eurb2: 4eur B:115-243

Lineage for d4eurb2 (4eur B:115-243)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4eurb2: 4eur B:115-243 [220855]
   Other proteins in same PDB: d4eura1, d4eura2

Details for d4eurb2

PDB Entry: 4eur, 2.1 Å

PDB Description: Crystal structure of the JKF6 TCR

PDB Compounds: (B:) JKF6 beta chain

SCOPe Domain Sequences for d4eurb2:

Sequence; same for both SEQRES and ATOM records:

>d4eurb2 b.1.1.0 (B:115-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlnkvfppevalfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglseadewtqdrakpvtqiv
saeawgrad

Timeline for d4eurb2:

• d4eurb2 first appeared in SCOPe 2.03
  
• d4eurb2 appears in SCOPe 2.05
  
• d4eurb2 appears in SCOPe 2.07
  
• d4eurb2 appears in the current release, SCOPe 2.08