Lineage for d4eura1 (4eur A:4-113)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1290033Species Human (Homo sapiens) [TaxId:9606] [188740] (75 PDB entries)
  8. 1290120Domain d4eura1: 4eur A:4-113 [220852]
    Other proteins in same PDB: d4eura2, d4eurb1, d4eurb2
    automated match to d1qrnd1

Details for d4eura1

PDB Entry: 4eur (more details), 2.1 Å

PDB Description: Crystal structure of the JKF6 TCR
PDB Compounds: (A:) JKF6 alpha chain

SCOPe Domain Sequences for d4eura1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eura1 b.1.1.1 (A:4-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimsiysngdkedgrft
aqlnkasqyvsllirdaqpsdsatylcavsgggadgltfgkgtqvvvtpn

SCOPe Domain Coordinates for d4eura1:

Click to download the PDB-style file with coordinates for d4eura1.
(The format of our PDB-style files is described here.)

Timeline for d4eura1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4eura2