Lineage for d4eudb2 (4eud B:230-505)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529545Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2529546Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2529832Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2529833Protein automated matches [191112] (16 species)
    not a true protein
  7. 2529838Species Acetobacter aceti [TaxId:435] [226493] (16 PDB entries)
  8. 2529871Domain d4eudb2: 4eud B:230-505 [220851]
    automated match to d2g39a2
    complexed with cit, cl, coa

Details for d4eudb2

PDB Entry: 4eud (more details), 1.95 Å

PDB Description: succinyl-coa:acetate coa-transferase (aarc) in complex with coa and citrate
PDB Compounds: (B:) Succinyl-CoA:acetate coenzyme A transferase

SCOPe Domain Sequences for d4eudb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eudb2 c.124.1.0 (B:230-505) automated matches {Acetobacter aceti [TaxId: 435]}
apfaapdetakaiagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenl
vgyseviqdgmlamldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnsp
giirrlgciamngmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakg
gkisaivpmaahvdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdy
fdralknsfgkhtphlltealswhqrfidtgtmlps

SCOPe Domain Coordinates for d4eudb2:

Click to download the PDB-style file with coordinates for d4eudb2.
(The format of our PDB-style files is described here.)

Timeline for d4eudb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4eudb1