Lineage for d4eudb1 (4eud B:2-229)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922594Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2922595Protein automated matches [191112] (17 species)
    not a true protein
  7. 2922600Species Acetobacter aceti [TaxId:435] [226493] (16 PDB entries)
  8. 2922632Domain d4eudb1: 4eud B:2-229 [220850]
    automated match to d2g39a1
    complexed with cit, cl, coa

Details for d4eudb1

PDB Entry: 4eud (more details), 1.95 Å

PDB Description: succinyl-coa:acetate coa-transferase (aarc) in complex with coa and citrate
PDB Compounds: (B:) Succinyl-CoA:acetate coenzyme A transferase

SCOPe Domain Sequences for d4eudb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eudb1 c.124.1.0 (B:2-229) automated matches {Acetobacter aceti [TaxId: 435]}
terirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrgek
yqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagra
vqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegihd
iwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrn

SCOPe Domain Coordinates for d4eudb1:

Click to download the PDB-style file with coordinates for d4eudb1.
(The format of our PDB-style files is described here.)

Timeline for d4eudb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4eudb2