Lineage for d4euba2 (4eub A:230-505)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1395793Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 1395794Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 1396069Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 1396070Protein automated matches [191112] (8 species)
    not a true protein
  7. 1396071Species Acetobacter aceti [TaxId:435] [226493] (12 PDB entries)
  8. 1396097Domain d4euba2: 4eub A:230-505 [220841]
    automated match to d2g39a2
    complexed with cl, coa

Details for d4euba2

PDB Entry: 4eub (more details), 1.97 Å

PDB Description: succinyl-coa:acetate coa-transferase (aarch6-e294a) in complex with coa
PDB Compounds: (A:) Succinyl-CoA:acetate coenzyme A transferase

SCOPe Domain Sequences for d4euba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4euba2 c.124.1.0 (A:230-505) automated matches {Acetobacter aceti [TaxId: 435]}
apfaapdetakaiagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenl
vgysaviqdgmlamldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnsp
giirrlgciamngmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakg
gkisaivpmaahvdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdy
fdralknsfgkhtphlltealswhqrfidtgtmlps

SCOPe Domain Coordinates for d4euba2:

Click to download the PDB-style file with coordinates for d4euba2.
(The format of our PDB-style files is described here.)

Timeline for d4euba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4euba1