![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) ![]() |
![]() | Family c.124.1.0: automated matches [191609] (1 protein) not a true family |
![]() | Protein automated matches [191112] (17 species) not a true protein |
![]() | Species Acetobacter aceti [TaxId:435] [226493] (16 PDB entries) |
![]() | Domain d4euab1: 4eua B:2-230 [220838] Other proteins in same PDB: d4euaa3 automated match to d2g39a1 complexed with cl, coa |
PDB Entry: 4eua (more details), 2.4 Å
SCOPe Domain Sequences for d4euab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4euab1 c.124.1.0 (B:2-230) automated matches {Acetobacter aceti [TaxId: 435]} terirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrgek yqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagra vqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegihd iwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdena
Timeline for d4euab1: