SCOPe 2.07: Domain d4euaa1: 4eua A:2-230

Lineage for d4euaa1 (4eua A:2-230)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.0: automated matches [191609] (1 protein)
   not a true family

6. Protein automated matches [191112] (16 species)
   not a true protein

7. Species Acetobacter aceti [TaxId:435] [226493] (16 PDB entries)

8. Domain d4euaa1: 4eua A:2-230 [220836]
   Other proteins in same PDB: d4euaa3
   automated match to d2g39a1
   complexed with cl, coa

Details for d4euaa1

PDB Entry: 4eua, 2.4 Å

PDB Description: succinyl-coa:acetate coa-transferase (aarch6-r228e) in complex with coa (anomalous dataset)

PDB Compounds: (A:) Succinyl-CoA:acetate coenzyme A transferase

SCOPe Domain Sequences for d4euaa1:

Sequence; same for both SEQRES and ATOM records:

>d4euaa1 c.124.1.0 (A:2-230) automated matches {Acetobacter aceti [TaxId: 435]}
terirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrgek
yqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagra
vqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegihd
iwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdena

Timeline for d4euaa1:

• d4euaa1 first appeared in SCOPe 2.03
  
• d4euaa1 appears in SCOPe 2.06
  
• d4euaa1 appears in the current release, SCOPe 2.08