| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) ![]() |
| Family c.124.1.0: automated matches [191609] (1 protein) not a true family |
| Protein automated matches [191112] (17 species) not a true protein |
| Species Acetobacter aceti [TaxId:435] [226493] (16 PDB entries) |
| Domain d4eu9b2: 4eu9 B:231-505 [220835] Other proteins in same PDB: d4eu9a3 automated match to d2g39a2 complexed with cl, coa |
PDB Entry: 4eu9 (more details), 1.48 Å
SCOPe Domain Sequences for d4eu9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eu9b2 c.124.1.0 (B:231-505) automated matches {Acetobacter aceti [TaxId: 435]}
pfaapdetakaiagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenlv
gyseviqdgmlamldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnspg
iirrlgciamngmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakgg
kisaivpmaahvdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdyf
dralknsfgkhtphlltealswhqrfidtgtmlps
Timeline for d4eu9b2: