Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) |
Family c.124.1.0: automated matches [191609] (1 protein) not a true family |
Protein automated matches [191112] (8 species) not a true protein |
Species Acetobacter aceti [TaxId:435] [226493] (12 PDB entries) |
Domain d4eu7a2: 4eu7 A:230-514 [220825] automated match to d2g39a2 complexed with cit, cl, coa |
PDB Entry: 4eu7 (more details), 1.7 Å
SCOPe Domain Sequences for d4eu7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eu7a2 c.124.1.0 (A:230-514) automated matches {Acetobacter aceti [TaxId: 435]} apfaapdetakaiagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenl vgyseviqdgmlamldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnsp giirrlgciamngmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakg gkisaivpmaahvdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdy fdralknsfgkhtphlltealswhqrfidtgtmlpsslehhhhhh
Timeline for d4eu7a2: