Lineage for d4eu1b_ (4eu1 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2898177Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226378] (1 PDB entry)
  8. 2898179Domain d4eu1b_: 4eu1 B: [220807]
    automated match to d7aata_
    complexed with cl, edo

Details for d4eu1b_

PDB Entry: 4eu1 (more details), 2.3 Å

PDB Description: structure of a mitochondrial aspartate aminotransferase from trypanosoma brucei
PDB Compounds: (B:) Mitochondrial aspartate aminotransferase

SCOPe Domain Sequences for d4eu1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eu1b_ c.67.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
lglgqdfrmdpakrkvnlsigvyrddadqpfvlecvkqatlgtnmdyapvtgiasfveea
qklcfgptcaalrdgriascqtlggtgalriggdllnrfvancnriygpdvgypnhesif
akagmeltpysyydpatkglnlagmlecldkapegsvilvhacahnptgvdpthddwrqv
cdvikrrnhipfvdmayqgfatgqldydafvprhlvdmvpnlivaqsfsknfglyghrcg
alhistasaeeakrlvsqlallirpmynnpplygawvvssilkdpqltalwkkelkqmss
riaevrkrlvselkacgsvhdwshierqvgmmaytgltreqvellrseyhiymtlngraa
vsglnstnveyvsqaihnvtk

SCOPe Domain Coordinates for d4eu1b_:

Click to download the PDB-style file with coordinates for d4eu1b_.
(The format of our PDB-style files is described here.)

Timeline for d4eu1b_: