SCOPe 2.07: Domain d4eu1b_: 4eu1 B:

Lineage for d4eu1b_ (4eu1 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (123 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226378] (1 PDB entry)

8. Domain d4eu1b_: 4eu1 B: [220807]
   automated match to d7aata_
   complexed with cl, edo

Details for d4eu1b_

PDB Entry: 4eu1, 2.3 Å

PDB Description: structure of a mitochondrial aspartate aminotransferase from trypanosoma brucei

PDB Compounds: (B:) Mitochondrial aspartate aminotransferase

SCOPe Domain Sequences for d4eu1b_:

Sequence; same for both SEQRES and ATOM records:

>d4eu1b_ c.67.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
lglgqdfrmdpakrkvnlsigvyrddadqpfvlecvkqatlgtnmdyapvtgiasfveea
qklcfgptcaalrdgriascqtlggtgalriggdllnrfvancnriygpdvgypnhesif
akagmeltpysyydpatkglnlagmlecldkapegsvilvhacahnptgvdpthddwrqv
cdvikrrnhipfvdmayqgfatgqldydafvprhlvdmvpnlivaqsfsknfglyghrcg
alhistasaeeakrlvsqlallirpmynnpplygawvvssilkdpqltalwkkelkqmss
riaevrkrlvselkacgsvhdwshierqvgmmaytgltreqvellrseyhiymtlngraa
vsglnstnveyvsqaihnvtk

Timeline for d4eu1b_:

• d4eu1b_ first appeared in SCOPe 2.03
  
• d4eu1b_ appears in SCOPe 2.06