Lineage for d1dp0d2 (1dp0 D:626-730)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) 
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins) Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species) Species Escherichia coli [TaxId:562] [49306] (23 PDB entries) 
Domain d1dp0d2: 1dp0 D:626-730 [22080]
Other proteins in same PDB: d1dp0a3, d1dp0a4, d1dp0a5, d1dp0b3, d1dp0b4, d1dp0b5, d1dp0c3, d1dp0c4, d1dp0c5, d1dp0d3, d1dp0d4, d1dp0d5
Details for d1dp0d2
PDB Entry: 1dp0 (more details), 1.7 Å
PDB Description: e. coli beta-galactosidase at 1.7 angstrom
SCOP Domain Sequences for d1dp0d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dp0d2 b.1.4.1 (D:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
SCOP Domain Coordinates for d1dp0d2:
Click to download the PDB-style file with coordinates for d1dp0d2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dp0d2:
- d1dp0d2 first appeared (with stable ids) in SCOP 1.55
- d1dp0d2 appears in SCOP 1.59
- d1dp0d2 appears in SCOP 1.63
- d1dp0d2 appears in the current release, SCOPe 2.08
 View in 3DDomains from same chain: (mouse over for more information) d1dp0d1, d1dp0d3, d1dp0d4, d1dp0d5 |
