SCOPe 2.05: Domain d4eraa_: 4era A:

Lineage for d4eraa_ (4era A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.15: PP1699/LP2961-like [141819] (6 proteins)
   Pfam PF04909; Amidohydrolase; stand-alone domain

6. Protein 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD [141824] (1 species)

7. Species Pseudomonas fluorescens [TaxId:294] [141825] (10 PDB entries)
   Uniprot Q83V25 3-333

8. Domain d4eraa_: 4era A: [220781]
   automated match to d4erib_
   complexed with co

Details for d4eraa_

PDB Entry: 4era, 2.4 Å

PDB Description: Evidence for a Dual Role of an Active Site Histidine in alpha-Amino-beta-Carboxymuconate-epsilon-Semialdehyde Decarboxylase

PDB Compounds: (A:) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase

SCOPe Domain Sequences for d4eraa_:

Sequence; same for both SEQRES and ATOM records:

>d4eraa_ c.1.9.15 (A:) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD {Pseudomonas fluorescens [TaxId: 294]}
kpridmhshffpriseqeaakfdanhapwlqvsakgdtgsimmgknnfrpvyqalwdpaf
rieemdaqgvdvqvtcatpvmfgytweankaaqwaermndfalefaahnpqrikvlaqvp
lqdldlackeasravaaghlgiqignhlgdkdlddatleaflthcanedipilvhpwdmm
ggqrmkkwmlpwlvampaetqlailslilsgaferipkslkicfgygggsfafllgrvdn
awrhrdivredcprppseyvdrffvdsavfnpgalellvsvmgedrvmlgsdypfplgeq
kigglvlssnlgesakdkiisgnaskffninv

Timeline for d4eraa_:

• d4eraa_ first appeared in SCOPe 2.03
  
• d4eraa_ appears in SCOPe 2.04
  
• d4eraa_ appears in SCOPe 2.06
  
• d4eraa_ appears in the current release, SCOPe 2.08