Lineage for d4er9a_ (4er9 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699500Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2699501Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
    automatically mapped to Pfam PF07361
  6. 2699739Protein automated matches [190502] (2 species)
    not a true protein
  7. 2699786Species Salmonella enterica [TaxId:90371] [226371] (1 PDB entry)
  8. 2699787Domain d4er9a_: 4er9 A: [220780]
    automated match to d256ba_
    complexed with gol, peg, so4

Details for d4er9a_

PDB Entry: 4er9 (more details), 1.9 Å

PDB Description: Crystal structure of cytochrome b562 from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
PDB Compounds: (A:) Soluble cytochrome b562

SCOPe Domain Sequences for d4er9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4er9a_ a.24.3.1 (A:) automated matches {Salmonella enterica [TaxId: 90371]}
adlednmdilndnlkvvektdsapelkaaltkmraaaldaqkatppkledkapdspemkd
frhgfdilvgqidgalklanegnvkeakaaaealkttrntyhkky

SCOPe Domain Coordinates for d4er9a_:

Click to download the PDB-style file with coordinates for d4er9a_.
(The format of our PDB-style files is described here.)

Timeline for d4er9a_: