| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.3: Cytochromes [47175] (3 families) ![]() Heme-containing proteins |
| Family a.24.3.1: Cytochrome b562 [47176] (2 proteins) automatically mapped to Pfam PF07361 |
| Protein automated matches [190502] (2 species) not a true protein |
| Species Salmonella enterica [TaxId:90371] [226371] (1 PDB entry) |
| Domain d4er9a_: 4er9 A: [220780] automated match to d256ba_ complexed with gol, peg, so4 |
PDB Entry: 4er9 (more details), 1.9 Å
SCOPe Domain Sequences for d4er9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4er9a_ a.24.3.1 (A:) automated matches {Salmonella enterica [TaxId: 90371]}
adlednmdilndnlkvvektdsapelkaaltkmraaaldaqkatppkledkapdspemkd
frhgfdilvgqidgalklanegnvkeakaaaealkttrntyhkky
Timeline for d4er9a_: