SCOPe 2.07: Domain d4er9a_: 4er9 A:

Lineage for d4er9a_ (4er9 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 protein domains)
   automatically mapped to Pfam PF07361

6. Protein automated matches [190502] (2 species)
   not a true protein

7. Species Salmonella enterica [TaxId:90371] [226371] (1 PDB entry)

8. Domain d4er9a_: 4er9 A: [220780]
   automated match to d256ba_
   complexed with gol, peg, so4

Details for d4er9a_

PDB Entry: 4er9, 1.9 Å

PDB Description: Crystal structure of cytochrome b562 from Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S

PDB Compounds: (A:) Soluble cytochrome b562

SCOPe Domain Sequences for d4er9a_:

Sequence; same for both SEQRES and ATOM records:

>d4er9a_ a.24.3.1 (A:) automated matches {Salmonella enterica [TaxId: 90371]}
adlednmdilndnlkvvektdsapelkaaltkmraaaldaqkatppkledkapdspemkd
frhgfdilvgqidgalklanegnvkeakaaaealkttrntyhkky

Timeline for d4er9a_:

• d4er9a_ first appeared in SCOPe 2.03
  
• d4er9a_ appears in SCOPe 2.06