Lineage for d4eqyb_ (4eqy B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079733Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2079734Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2080029Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2080030Protein automated matches [190967] (30 species)
    not a true protein
  7. 2080084Species Burkholderia thailandensis [TaxId:271848] [226377] (1 PDB entry)
  8. 2080086Domain d4eqyb_: 4eqy B: [220775]
    automated match to d2qiaa_

Details for d4eqyb_

PDB Entry: 4eqy (more details), 1.8 Å

PDB Description: Crystal structure of Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase from Burkholderia thailandensis
PDB Compounds: (B:) acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase

SCOPe Domain Sequences for d4eqyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eqyb_ b.81.1.0 (B:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
srihptaiiepgaqlhetvevgpyaivgsnvtigarttigshsvieghttigednrighy
asvggrpqdmkykdeptrlvigdrntirefttihtgtvqdagvttlgddnwimayvhigh
dcrvgshvvlssnaqmaghveigdwaivggmsgvhqyvrigahsmlggasalvqdippfv
iaagnkaephginveglrrrgfspdaisalrsayrilyknslsleeakvqlselaqaggd
gdaavkalvdfvessqrgiir

SCOPe Domain Coordinates for d4eqyb_:

Click to download the PDB-style file with coordinates for d4eqyb_.
(The format of our PDB-style files is described here.)

Timeline for d4eqyb_: