![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
![]() | Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) ![]() superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
![]() | Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
![]() | Protein automated matches [190967] (30 species) not a true protein |
![]() | Species Burkholderia thailandensis [TaxId:271848] [226377] (1 PDB entry) |
![]() | Domain d4eqyb_: 4eqy B: [220775] automated match to d2qiaa_ |
PDB Entry: 4eqy (more details), 1.8 Å
SCOPe Domain Sequences for d4eqyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eqyb_ b.81.1.0 (B:) automated matches {Burkholderia thailandensis [TaxId: 271848]} srihptaiiepgaqlhetvevgpyaivgsnvtigarttigshsvieghttigednrighy asvggrpqdmkykdeptrlvigdrntirefttihtgtvqdagvttlgddnwimayvhigh dcrvgshvvlssnaqmaghveigdwaivggmsgvhqyvrigahsmlggasalvqdippfv iaagnkaephginveglrrrgfspdaisalrsayrilyknslsleeakvqlselaqaggd gdaavkalvdfvessqrgiir
Timeline for d4eqyb_: