SCOPe 2.03: Domain d4eqyb_: 4eqy B:

Lineage for d4eqyb_ (4eqy B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (25 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [226377] (1 PDB entry)

8. Domain d4eqyb_: 4eqy B: [220775]
   automated match to d2qiaa_

Details for d4eqyb_

PDB Entry: 4eqy, 1.8 Å

PDB Description: Crystal structure of Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase from Burkholderia thailandensis

PDB Compounds: (B:) acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase

SCOPe Domain Sequences for d4eqyb_:

Sequence; same for both SEQRES and ATOM records:

>d4eqyb_ b.81.1.0 (B:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
srihptaiiepgaqlhetvevgpyaivgsnvtigarttigshsvieghttigednrighy
asvggrpqdmkykdeptrlvigdrntirefttihtgtvqdagvttlgddnwimayvhigh
dcrvgshvvlssnaqmaghveigdwaivggmsgvhqyvrigahsmlggasalvqdippfv
iaagnkaephginveglrrrgfspdaisalrsayrilyknslsleeakvqlselaqaggd
gdaavkalvdfvessqrgiir

Timeline for d4eqyb_:

• d4eqyb_ is new in SCOPe 2.03-stable
  
• d4eqyb_ appears in SCOPe 2.04
  
• d4eqyb_ appears in the current release, SCOPe 2.08