SCOPe 2.06: Domain d4eqbb_: 4eqb B:

Lineage for d4eqbb_ (4eqb B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:525381] [226370] (1 PDB entry)

8. Domain d4eqbb_: 4eqb B: [220772]
   automated match to d4gl0a_
   complexed with ca, cl, epe, peg

Details for d4eqbb_

PDB Entry: 4eqb, 1.5 Å

PDB Description: 1.5 angstrom crystal structure of spermidine/putrescine abc transporter substrate-binding protein potd from streptococcus pneumoniae strain canada mdr_19a in complex with calcium and hepes

PDB Compounds: (B:) Spermidine/putrescine ABC superfamily ATP binding cassette transporter, binding protein

SCOPe Domain Sequences for d4eqbb_:

Sequence; same for both SEQRES and ATOM records:

>d4eqbb_ c.94.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 525381]}
sqklviynwgdyidpelltqfteetgiqvqyetfdsneamytkikqggttydiaipseym
inkmkdedllvpldyskiegienigpeflnqsfdpgnkfsipyfwgtlgivynetmvdea
pehwddlwkleyknsimlfdgarevlglglnslgyslnskdpqqleetvdklykltpnik
aivademkgymiqnnvaigvtfsgeasqmleknenlryvvpteasnlwfdnmvipktvkn
qdsayafinfmlkpenalqnaeyvgystpnlpakellpeetkedkafypdvetmkhlevy
ekfdhkwtgkysdlflqfkmyrk

Timeline for d4eqbb_:

• d4eqbb_ first appeared in SCOPe 2.03
  
• d4eqbb_ appears in SCOPe 2.05
  
• d4eqbb_ appears in SCOPe 2.07
  
• d4eqbb_ appears in the current release, SCOPe 2.08