Lineage for d4eqba_ (4eqb A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2523544Species Streptococcus pneumoniae [TaxId:525381] [226370] (1 PDB entry)
  8. 2523545Domain d4eqba_: 4eqb A: [220771]
    automated match to d4gl0a_
    complexed with ca, cl, epe, peg

Details for d4eqba_

PDB Entry: 4eqb (more details), 1.5 Å

PDB Description: 1.5 angstrom crystal structure of spermidine/putrescine abc transporter substrate-binding protein potd from streptococcus pneumoniae strain canada mdr_19a in complex with calcium and hepes
PDB Compounds: (A:) Spermidine/putrescine ABC superfamily ATP binding cassette transporter, binding protein

SCOPe Domain Sequences for d4eqba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eqba_ c.94.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 525381]}
sqklviynwgdyidpelltqfteetgiqvqyetfdsneamytkikqggttydiaipseym
inkmkdedllvpldyskiegienigpeflnqsfdpgnkfsipyfwgtlgivynetmvdea
pehwddlwkleyknsimlfdgarevlglglnslgyslnskdpqqleetvdklykltpnik
aivademkgymiqnnvaigvtfsgeasqmleknenlryvvpteasnlwfdnmvipktvkn
qdsayafinfmlkpenalqnaeyvgystpnlpakellpeetkedkafypdvetmkhlevy
ekfdhkwtgkysdlflqfkmyrk

SCOPe Domain Coordinates for d4eqba_:

Click to download the PDB-style file with coordinates for d4eqba_.
(The format of our PDB-style files is described here.)

Timeline for d4eqba_: