Lineage for d4ep6a_ (4ep6 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278212Species Rhodococcus rhodochrous [TaxId:1829] [226369] (1 PDB entry)
  8. 1278213Domain d4ep6a_: 4ep6 A: [220767]
    automated match to d1q5da_
    complexed with 1pe, hem, imd

Details for d4ep6a_

PDB Entry: 4ep6 (more details), 2.3 Å

PDB Description: Crystal structure of the XplA heme domain in complex with imidazole and PEG
PDB Compounds: (A:) cytochrome p450-like protein xpla

SCOPe Domain Sequences for d4ep6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ep6a_ a.104.1.0 (A:) automated matches {Rhodococcus rhodochrous [TaxId: 1829]}
aasidrelvpwsdpefrnnpypwyrrlqqdhpvhkledgtylvsryadvshfaklpimsv
epgwadagpwavasdtalgsdpphhtvlrrqtnkwftpklvdgwvrttrelvgdlldgve
agqviearrdlavvpthvtmarvlqlpeddadavmeamfeamlmqsaepadgdvdraava
fgylsarvaemledkrvnpgdgladslldaarageiteseaiatilvfyavghmaigyli
asgielfarrpevftafrndesaraaiinemvrmdppqlsflrfptedveiggvlieags
pirfmigaanrdpevfddpdvfdhtrppaasrnlsfglgphscagqiisraeattvfavl
aeryerielaeeptvahndfarryrklpivls

SCOPe Domain Coordinates for d4ep6a_:

Click to download the PDB-style file with coordinates for d4ep6a_.
(The format of our PDB-style files is described here.)

Timeline for d4ep6a_: