![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Rhodococcus rhodochrous [TaxId:1829] [226369] (1 PDB entry) |
![]() | Domain d4ep6a_: 4ep6 A: [220767] automated match to d1q5da_ complexed with 1pe, hem, imd |
PDB Entry: 4ep6 (more details), 2.3 Å
SCOPe Domain Sequences for d4ep6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ep6a_ a.104.1.0 (A:) automated matches {Rhodococcus rhodochrous [TaxId: 1829]} aasidrelvpwsdpefrnnpypwyrrlqqdhpvhkledgtylvsryadvshfaklpimsv epgwadagpwavasdtalgsdpphhtvlrrqtnkwftpklvdgwvrttrelvgdlldgve agqviearrdlavvpthvtmarvlqlpeddadavmeamfeamlmqsaepadgdvdraava fgylsarvaemledkrvnpgdgladslldaarageiteseaiatilvfyavghmaigyli asgielfarrpevftafrndesaraaiinemvrmdppqlsflrfptedveiggvlieags pirfmigaanrdpevfddpdvfdhtrppaasrnlsfglgphscagqiisraeattvfavl aeryerielaeeptvahndfarryrklpivls
Timeline for d4ep6a_: