Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries) |
Domain d4eowl2: 4eow L:112-212 [220766] Other proteins in same PDB: d4eowl1 automated match to d1aqkl2 |
PDB Entry: 4eow (more details), 1.97 Å
SCOPe Domain Sequences for d4eowl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eowl2 b.1.1.2 (L:112-212) automated matches {Human (Homo sapiens) [TaxId: 9606]} qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvap
Timeline for d4eowl2: