SCOPe 2.08: Domain d4eold2: 4eol D:310-431

Lineage for d4eold2 (4eol D:310-431)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
   Uniprot P20248 175-432

8. Domain d4eold2: 4eol D:310-431 [220764]
   Other proteins in same PDB: d4eola1, d4eola2, d4eolc1, d4eolc2
   automated match to d1h1pb2
   complexed with 1ro, mg, sgm

Details for d4eold2

PDB Entry: 4eol, 2.4 Å

PDB Description: thr 160 phosphorylated cdk2 h84s, q85m, k89d - human cyclin a3 complex with the inhibitor ro3306

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d4eold2:

Sequence; same for both SEQRES and ATOM records:

>d4eold2 a.74.1.1 (D:310-431) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
ln

Timeline for d4eold2:

• d4eold2 first appeared in SCOPe 2.03
  
• d4eold2 appears in SCOPe 2.07