Lineage for d4eold1 (4eol D:176-309)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718090Protein Cyclin A [47956] (2 species)
  7. 2718126Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
    Uniprot P20248 175-432
  8. 2718233Domain d4eold1: 4eol D:176-309 [220763]
    Other proteins in same PDB: d4eola1, d4eola2, d4eolc1, d4eolc2
    automated match to d1h1pb1
    complexed with 1ro, mg, sgm

Details for d4eold1

PDB Entry: 4eol (more details), 2.4 Å

PDB Description: thr 160 phosphorylated cdk2 h84s, q85m, k89d - human cyclin a3 complex with the inhibitor ro3306
PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d4eold1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eold1 a.74.1.1 (D:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
hlvlkvltfdlaap

SCOPe Domain Coordinates for d4eold1:

Click to download the PDB-style file with coordinates for d4eold1.
(The format of our PDB-style files is described here.)

Timeline for d4eold1: