SCOPe 2.04: Domain d4enya_: 4eny A:

Lineage for d4enya_ (4eny A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species)
   OPK group(?); PIM subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [118134] (65 PDB entries)
   Uniprot P11309 33-305 ! Uniprot P11309 32-308

8. Domain d4enya_: 4eny A: [220754]
   automated match to d3jy0a_
   complexed with dms, gol, j19, po4

Details for d4enya_

PDB Entry: 4eny, 2.8 Å

PDB Description: Crystal Structure of Pim-1 kinase in complex with (2E,5Z)-2-(2-chlorophenylimino)-5-(4-hydroxy-3-methoxybenzylidene)thiazolidin-4-one

PDB Compounds: (A:) Serine/threonine-protein kinase pim-1

SCOPe Domain Sequences for d4enya_:

Sequence, based on SEQRES records:

>d4enya_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
qyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvllkkv
ssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvleavr
hchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewiryh
ryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwclalrps
drptfeeiqnhpwmqdvllpqetaeihlh

Sequence, based on observed residues (ATOM records):

>d4enya_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
qyqvgpllgsgfgsvysgirvsdnlpvaikhvekdrisdwgrvpmevvllkkvssfsgvi
rlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvleavrhchncgvl
hrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewiryhryhgrsaa
vwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwclalrpsdrptfeei
qnhpwmqdvllpqetaeihlh

Timeline for d4enya_:

• d4enya_ first appeared in SCOPe 2.03
  
• d4enya_ appears in SCOPe 2.05
  
• d4enya_ appears in the current release, SCOPe 2.08