Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
Protein automated matches [190197] (18 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [226043] (19 PDB entries) |
Domain d4envc2: 4env C:598-753 [220742] Other proteins in same PDB: d4enva1, d4envb1, d4envc1, d4envd1 automated match to d1p80a1 complexed with hdd, hem |
PDB Entry: 4env (more details), 1.7 Å
SCOPe Domain Sequences for d4envc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4envc2 c.23.16.0 (C:598-753) automated matches {Escherichia coli K-12 [TaxId: 83333]} vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg iveadsadgsfmdelltlmaahrvwsripkidkipa
Timeline for d4envc2: