SCOPe 2.07: Domain d1bpva1: 1bpv A:1-103

Lineage for d1bpva1 (1bpv A:1-103)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Type I titin module [49297] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49298] (1 PDB entry)

8. Domain d1bpva1: 1bpv A:1-103 [22071]
   Other proteins in same PDB: d1bpva2
   module a71

Details for d1bpva1

PDB Entry: 1bpv

PDB Description: titin module a71 from human cardiac muscle, nmr, 50 structures

PDB Compounds: (A:) titin

SCOPe Domain Sequences for d1bpva1:

Sequence; same for both SEQRES and ATOM records:

>d1bpva1 b.1.2.1 (A:1-103) Type I titin module {Human (Homo sapiens) [TaxId: 9606]}
pidppgkpvplnitrhtvtlkwakpeytggfkitsyivekrdlpngrwlkanfsnilene
ftvsgltedaayefrviaknaagaisppsepsdaitcrddvea

Timeline for d1bpva1:

• d1bpva1 first appeared (with stable ids) in SCOP 1.55, called d1bpv__
  
• d1bpva1 appears in SCOPe 2.06
  
• d1bpva1 appears in the current release, SCOPe 2.08