Lineage for d1bpva_ (1bpv A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1767525Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1767526Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1767982Protein Type I titin module [49297] (1 species)
  7. 1767983Species Human (Homo sapiens) [TaxId:9606] [49298] (1 PDB entry)
  8. 1767984Domain d1bpva_: 1bpv A: [22071]
    module a71

Details for d1bpva_

PDB Entry: 1bpv (more details)

PDB Description: titin module a71 from human cardiac muscle, nmr, 50 structures
PDB Compounds: (A:) titin

SCOPe Domain Sequences for d1bpva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]}
spidppgkpvplnitrhtvtlkwakpeytggfkitsyivekrdlpngrwlkanfsnilen
eftvsgltedaayefrviaknaagaisppsepsdaitcrddvea

SCOPe Domain Coordinates for d1bpva_:

Click to download the PDB-style file with coordinates for d1bpva_.
(The format of our PDB-style files is described here.)

Timeline for d1bpva_: