Lineage for d1bpv__ (1bpv -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.2: Fibronectin type III [49265] (1 family) 
Family b.1.2.1: Fibronectin type III [49266] (14 proteins) 
Protein Type I titin module [49297] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49298] (1 PDB entry) 
Domain d1bpv__: 1bpv - [22071]
Details for d1bpv__
PDB Entry: 1bpv (more details)
PDB Description: titin module a71 from human cardiac muscle, nmr, 50 structures
SCOP Domain Sequences for d1bpv__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bpv__ b.1.2.1 (-) Type I titin module {Human (Homo sapiens)}
spidppgkpvplnitrhtvtlkwakpeytggfkitsyivekrdlpngrwlkanfsnilen
eftvsgltedaayefrviaknaagaisppsepsdaitcrddvea
SCOP Domain Coordinates for d1bpv__:
Click to download the PDB-style file with coordinates for d1bpv__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bpv__:
- d1bpv__ appears in SCOP 1.57
- d1bpv__ appears in the current release, SCOPe 2.08, called d1bpva1
View in 3D