Lineage for d1bpva1 (1bpv A:1-103)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762152Protein Type I titin module [49297] (1 species)
  7. 2762153Species Human (Homo sapiens) [TaxId:9606] [49298] (1 PDB entry)
  8. 2762154Domain d1bpva1: 1bpv A:1-103 [22071]
    Other proteins in same PDB: d1bpva2
    module a71

Details for d1bpva1

PDB Entry: 1bpv (more details)

PDB Description: titin module a71 from human cardiac muscle, nmr, 50 structures
PDB Compounds: (A:) titin

SCOPe Domain Sequences for d1bpva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bpva1 b.1.2.1 (A:1-103) Type I titin module {Human (Homo sapiens) [TaxId: 9606]}
pidppgkpvplnitrhtvtlkwakpeytggfkitsyivekrdlpngrwlkanfsnilene
ftvsgltedaayefrviaknaagaisppsepsdaitcrddvea

SCOPe Domain Coordinates for d1bpva1:

Click to download the PDB-style file with coordinates for d1bpva1.
(The format of our PDB-style files is described here.)

Timeline for d1bpva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bpva2