SCOPe 2.01: Domain d1bj8a_: 1bj8 A:

Lineage for d1bj8a_ (1bj8 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries)

8. Domain d1bj8a_: 1bj8 A: [22070]
   3rd N-terminal domain

Details for d1bj8a_

PDB Entry: 1bj8

PDB Description: third n-terminal domain of gp130, nmr, minimized average structure

PDB Compounds: (A:) gp130

SCOPe Domain Sequences for d1bj8a_:

Sequence; same for both SEQRES and ATOM records:

>d1bj8a_ b.1.2.1 (A:) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}
mdkvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyrtkdastwsqipped
tastrssftvqdlkpfteyvfrircmkedgkgywsdwseeasgityedr

Timeline for d1bj8a_:

• d1bj8a_ first appeared (with stable ids) in SCOP 1.55, called d1bj8__
  
• d1bj8a_ appears in SCOP 1.75
  
• d1bj8a_ appears in SCOPe 2.02
  
• d1bj8a_ appears in the current release, SCOPe 2.08, called d1bj8a1