Lineage for d1bj8a_ (1bj8 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 935729Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 935730Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 935771Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species)
  7. 935772Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries)
  8. 935787Domain d1bj8a_: 1bj8 A: [22070]
    3rd N-terminal domain

Details for d1bj8a_

PDB Entry: 1bj8 (more details)

PDB Description: third n-terminal domain of gp130, nmr, minimized average structure
PDB Compounds: (A:) gp130

SCOPe Domain Sequences for d1bj8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bj8a_ b.1.2.1 (A:) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}
mdkvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyrtkdastwsqipped
tastrssftvqdlkpfteyvfrircmkedgkgywsdwseeasgityedr

SCOPe Domain Coordinates for d1bj8a_:

Click to download the PDB-style file with coordinates for d1bj8a_.
(The format of our PDB-style files is described here.)

Timeline for d1bj8a_: