SCOPe 2.08: Domain d4enee1: 4ene E:2-121

Lineage for d4enee1 (4ene E:2-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (62 PDB entries)
   Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10

8. Domain d4enee1: 4ene E:2-121 [220685]
   Other proteins in same PDB: d4enea_, d4eneb_, d4enec2, d4ened1, d4ened2, d4enee2, d4enef1, d4enef2
   automated match to d1otsc1
   complexed with cl, dmu

Details for d4enee1

PDB Entry: 4ene, 2.4 Å

PDB Description: structure of the n- and c-terminal trimmed clc-ec1 cl-/h+ antiporter and fab complex

PDB Compounds: (E:) heavy chain of Fab fragment

SCOPe Domain Sequences for d4enee1:

Sequence; same for both SEQRES and ATOM records:

>d4enee1 b.1.1.1 (E:2-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss

Timeline for d4enee1:

• d4enee1 first appeared in SCOPe 2.03
  
• d4enee1 appears in SCOPe 2.07