SCOPe 2.07: Domain d4ened2: 4ene D:107-211

Lineage for d4ened2 (4ene D:107-211)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (368 PDB entries)
   Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region

8. Domain d4ened2: 4ene D:107-211 [220684]
   Other proteins in same PDB: d4enea_, d4eneb_, d4enec1, d4enec2, d4ened1, d4enee1, d4enee2, d4enef1
   automated match to d1otsd2
   complexed with cl, dmu, mal

Details for d4ened2

PDB Entry: 4ene, 2.4 Å

PDB Description: structure of the n- and c-terminal trimmed clc-ec1 cl-/h+ antiporter and fab complex

PDB Compounds: (D:) light chain of Fab fragment

SCOPe Domain Sequences for d4ened2:

Sequence; same for both SEQRES and ATOM records:

>d4ened2 b.1.1.2 (D:107-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

Timeline for d4ened2:

• d4ened2 first appeared in SCOPe 2.03
  
• d4ened2 appears in SCOPe 2.06
  
• d4ened2 appears in the current release, SCOPe 2.08