Lineage for d4ened1 (4ene D:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2741215Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (43 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 2741219Domain d4ened1: 4ene D:1-106 [220683]
    Other proteins in same PDB: d4enea_, d4eneb_, d4enec1, d4enec2, d4ened2, d4enee1, d4enee2, d4enef2
    automated match to d1otsd1
    complexed with cl, dmu

Details for d4ened1

PDB Entry: 4ene (more details), 2.4 Å

PDB Description: structure of the n- and c-terminal trimmed clc-ec1 cl-/h+ antiporter and fab complex
PDB Compounds: (D:) light chain of Fab fragment

SCOPe Domain Sequences for d4ened1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ened1 b.1.1.1 (D:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

SCOPe Domain Coordinates for d4ened1:

Click to download the PDB-style file with coordinates for d4ened1.
(The format of our PDB-style files is described here.)

Timeline for d4ened1: