![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.20: Clc chloride channel [81341] (1 superfamily) core: 18 transmembrane helices |
![]() | Superfamily f.20.1: Clc chloride channel [81340] (1 family) ![]() |
![]() | Family f.20.1.1: Clc chloride channel [69912] (2 proteins) duplication: consist of two similar structural parts |
![]() | Protein automated matches [226846] (4 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [224947] (14 PDB entries) |
![]() | Domain d4enea_: 4ene A: [220679] Other proteins in same PDB: d4enec1, d4enec2, d4ened1, d4ened2, d4enee1, d4enee2, d4enef1, d4enef2 automated match to d1kpla_ complexed with cl, dmu |
PDB Entry: 4ene (more details), 2.4 Å
SCOPe Domain Sequences for d4enea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4enea_ f.20.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla qftggkplysailartlakqeaeq
Timeline for d4enea_: