![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
![]() | Family b.22.1.0: automated matches [191519] (1 protein) not a true family |
![]() | Protein automated matches [190873] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries) |
![]() | Domain d4en0c_: 4en0 C: [220676] automated match to d2re9a_ complexed with gol, nag, po4 |
PDB Entry: 4en0 (more details), 2.59 Å
SCOPe Domain Sequences for d4en0c_:
Sequence, based on SEQRES records: (download)
>d4en0c_ b.22.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg vgcplglastithglykrtprypeelellvsqqspcgratsssrvwwdssflggvvhlea geevvvrvlderlvrlrdgtrsyfgafmv
>d4en0c_ b.22.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vnpaahltganssgpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlggvgcpl glastithglykrtprypeelellvsqqspcgratsssrvwwdssflggvvhleageevv vrvlderlvrlrdgtrsyfgafmv
Timeline for d4en0c_: