Lineage for d1bqua2 (1bqu A:100-214)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1297328Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1297329Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1297372Protein Cytokine receptor gp130 cytokine-binding domains [49295] (1 species)
  7. 1297373Species Human (Homo sapiens) [TaxId:9606] [49296] (5 PDB entries)
  8. 1297375Domain d1bqua2: 1bqu A:100-214 [22067]
    complexed with gol, so4

Details for d1bqua2

PDB Entry: 1bqu (more details), 2 Å

PDB Description: cytokyne-binding region of gp130
PDB Compounds: (A:) protein (gp130)

SCOPe Domain Sequences for d1bqua2:

Sequence, based on SEQRES records: (download)

>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}
ykvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyrtkdastwsqippedt
astrssftvqdlkpfteyvfrircmkedgkgywsdwseeasgityedrpskepsf

Sequence, based on observed residues (ATOM records): (download)

>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}
ykvkpnpphnlsvinslssilkltwtnpsiksviilkyniqyrtkdastwsqippedtas
trssftvqdlkpfteyvfrircmkedgkgywsdwseeasgityedrpskepsf

SCOPe Domain Coordinates for d1bqua2:

Click to download the PDB-style file with coordinates for d1bqua2.
(The format of our PDB-style files is described here.)

Timeline for d1bqua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bqua1