Lineage for d4emxa2 (4emx A:197-388)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1503613Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 1503614Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 1503615Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 1503616Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 1503617Species Human (Homo sapiens) [TaxId:9606] [48555] (69 PDB entries)
    Uniprot P02768 29-596
  8. 1503622Domain d4emxa2: 4emx A:197-388 [220667]
    automated match to d1n5ua2
    complexed with cl

Details for d4emxa2

PDB Entry: 4emx (more details), 2.3 Å

PDB Description: crystal structure analysis of human serum albumin in complex with chloride anions at cryogenic temperature
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d4emxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4emxa2 a.126.1.1 (A:197-388) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

SCOPe Domain Coordinates for d4emxa2:

Click to download the PDB-style file with coordinates for d4emxa2.
(The format of our PDB-style files is described here.)

Timeline for d4emxa2: