Lineage for d4emqf_ (4emq F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1643322Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1643323Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1643884Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1643885Protein automated matches [190526] (18 species)
    not a true protein
  7. 1643952Species Echinophyllia sp. [TaxId:301887] [188534] (12 PDB entries)
  8. 1643998Domain d4emqf_: 4emq F: [220663]
    automated match to d1xssb_
    complexed with 1pe, epe, peg; mutant

Details for d4emqf_

PDB Entry: 4emq (more details), 1.95 Å

PDB Description: Crystal structure of a single mutant of Dronpa, the green-on-state PDM1-4
PDB Compounds: (F:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d4emqf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4emqf_ d.22.1.0 (F:) automated matches {Echinophyllia sp. [TaxId: 301887]}
svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
gvnfpangpvmqkrtvkwepstenlyvrdgvlkgdvnmalsleggghyrcdfkttykakk
vvqlpdyhfvdhhieikshdkdysnvnlhehaeahs

SCOPe Domain Coordinates for d4emqf_:

Click to download the PDB-style file with coordinates for d4emqf_.
(The format of our PDB-style files is described here.)

Timeline for d4emqf_: