Lineage for d4emqd_ (4emq D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2547682Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2547683Protein automated matches [190526] (25 species)
    not a true protein
  7. 2547822Species Echinophyllia sp. [TaxId:301887] [188534] (31 PDB entries)
  8. 2547856Domain d4emqd_: 4emq D: [220661]
    automated match to d1xssb_
    complexed with 1pe, epe, peg; mutant

Details for d4emqd_

PDB Entry: 4emq (more details), 1.95 Å

PDB Description: Crystal structure of a single mutant of Dronpa, the green-on-state PDM1-4
PDB Compounds: (D:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d4emqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4emqd_ d.22.1.0 (D:) automated matches {Echinophyllia sp. [TaxId: 301887]}
svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
gvnfpangpvmqkrtvkwepstenlyvrdgvlkgdvnmalsleggghyrcdfkttykakk
vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse

SCOPe Domain Coordinates for d4emqd_:

Click to download the PDB-style file with coordinates for d4emqd_.
(The format of our PDB-style files is described here.)

Timeline for d4emqd_: